Skip to content

科
科研小班
Commit 6f204617 by re
Options

特征工程

parents
Showing with 502 additions and 0 deletions
特征工程/.idea/.gitignore 0 → 100644
# Default ignored files
# Default ignored files
/shelf/
/workspace.xml
# Editor-based HTTP Client requests
/httpRequests/
# Datasource local storage ignored files
/dataSources/
/dataSources.local.xml
特征工程/.idea/inspectionProfiles/Project_Default.xml 0 → 100644
<component name="InspectionProjectProfileManager">
<component name="InspectionProjectProfileManager">
<profile version="1.0">
<option name="myName" value="Project Default" />
<inspection_tool class="PyUnresolvedReferencesInspection" enabled="true" level="WARNING" enabled_by_default="true">
<option name="ignoredIdentifiers">
<list>
<option value="tensorflow.compat" />
</list>
</option>
</inspection_tool>
</profile>
</component>
\ No newline at end of file
特征工程/.idea/inspectionProfiles/profiles_settings.xml 0 → 100644
<component name="InspectionProjectProfileManager">
<component name="InspectionProjectProfileManager">
<settings>
<option name="USE_PROJECT_PROFILE" value="false" />
<version value="1.0" />
</settings>
</component>
\ No newline at end of file
特征工程/.idea/misc.xml 0 → 100644
<?xml version="1.0" encoding="UTF-8"?>
<?xml version="1.0" encoding="UTF-8"?>
<project version="4">
<component name="ProjectRootManager" version="2" project-jdk-name="Python 3.11 (GoT2G-F-main) (2)" project-jdk-type="Python SDK" />
</project>
\ No newline at end of file
特征工程/.idea/modules.xml 0 → 100644
<?xml version="1.0" encoding="UTF-8"?>
<?xml version="1.0" encoding="UTF-8"?>
<project version="4">
<component name="ProjectModuleManager">
<modules>
<module fileurl="file://$PROJECT_DIR$/.idea/特征工程.iml" filepath="$PROJECT_DIR$/.idea/特征工程.iml" />
</modules>
</component>
</project>
\ No newline at end of file
特征工程/69TBYSC6014-Alignment.xml 0 → 100644
<?xml version="1.0" encoding="US-ASCII"?>
<?xml version="1.0" encoding="US-ASCII"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>blastp</BlastOutput_program>
<BlastOutput_version>BLASTP 2.17.0+</BlastOutput_version>
<BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
<BlastOutput_db>nr</BlastOutput_db>
<BlastOutput_query-ID>Query_613691</BlastOutput_query-ID>
<BlastOutput_query-def>lcl|1 unnamed protein product</BlastOutput_query-def>
<BlastOutput_query-len>93</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>0.05</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>Query_613691</Iteration_query-ID>
<Iteration_query-def>lcl|1 unnamed protein product</Iteration_query-def>
<Iteration_query-len>93</Iteration_query-len>
<Iteration_hits>
<Hit>
<Hit_num>1</Hit_num>
<Hit_id>pdb|7KAE|A</Hit_id>
<Hit_def>Chain A, Regulatory protein rop [Escherichia coli] &gt;pdb|7KAE|B Chain B, Regulatory protein rop [Escherichia coli]</Hit_def>
<Hit_accession>7KAE_A</Hit_accession>
<Hit_len>65</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>53.1434</Hsp_bit-score>
<Hsp_score>126</Hsp_score>
<Hsp_evalue>1.67188e-06</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>93</Hsp_query-to>
<Hsp_hit-from>1</Hsp_hit-from>
<Hsp_hit-to>65</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>41</Hsp_identity>
<Hsp_positive>51</Hsp_positive>
<Hsp_gaps>28</Hsp_gaps>
<Hsp_align-len>93</Hsp_align-len>
<Hsp_qseq>MGHHHHHHGTPEEKQALQMAKQIKQQAQEIQKQTEELLKKVQELLKKLHQLGAPEMAKIAEELHKHAEALKQAAEEFYKHAEELHKAAEARWG</Hsp_qseq>
<Hsp_hseq>MGHHHHHHGTKQEKTALNMARFIQNQ--------------TQTLLEKLNELDADEQADIAESLH--------------DHADELYRSALARWG</Hsp_hseq>
<Hsp_midline>MGHHHHHHGT +EK AL MA+ I+ Q Q LL+KL++L A E A IAE LH HA+EL+++A ARWG</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>2</Hit_num>
<Hit_id>ref|WP_068840410.1|</Hit_id>
<Hit_def>Rop family plasmid primer RNA-binding protein [Salmonella enterica] &gt;gb|OCT02482.1| hypothetical protein A7B04_25020 [Salmonella enterica subsp. enterica]</Hit_def>
<Hit_accession>WP_068840410</Hit_accession>
<Hit_len>63</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>45.0542</Hsp_bit-score>
<Hsp_score>105</Hsp_score>
<Hsp_evalue>0.00198286</Hsp_evalue>
<Hsp_query-from>10</Hsp_query-from>
<Hsp_query-to>93</Hsp_query-to>
<Hsp_hit-from>2</Hsp_hit-from>
<Hsp_hit-to>57</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>30</Hsp_identity>
<Hsp_positive>40</Hsp_positive>
<Hsp_gaps>28</Hsp_gaps>
<Hsp_align-len>84</Hsp_align-len>
<Hsp_qseq>TPEEKQALQMAKQIKQQAQEIQKQTEELLKKVQELLKKLHQLGAPEMAKIAEELHKHAEALKQAAEEFYKHAEELHKAAEARWG</Hsp_qseq>
<Hsp_hseq>TKQEKTALNMARIIKTQ--------------TRTLLKKLNKLDADEQADICESLH--------------DHADELYRSCLARFG</Hsp_hseq>
<Hsp_midline>T +EK AL MA+ IK Q + LLKKL++L A E A I E LH HA+EL+++ AR+G</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>3</Hit_num>
<Hit_id>ref|WP_105178307.1|</Hit_id>
<Hit_def>Rop family plasmid primer RNA-binding protein [Klebsiella pneumoniae] &gt;gb|PPJ97315.1| Rop family plasmid primer RNA-binding protein [Klebsiella pneumoniae]</Hit_def>
<Hit_accession>WP_105178307</Hit_accession>
<Hit_len>63</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>43.1282</Hsp_bit-score>
<Hsp_score>100</Hsp_score>
<Hsp_evalue>0.0120913</Hsp_evalue>
<Hsp_query-from>10</Hsp_query-from>
<Hsp_query-to>93</Hsp_query-to>
<Hsp_hit-from>2</Hsp_hit-from>
<Hsp_hit-to>57</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>29</Hsp_identity>
<Hsp_positive>39</Hsp_positive>
<Hsp_gaps>28</Hsp_gaps>
<Hsp_align-len>84</Hsp_align-len>
<Hsp_qseq>TPEEKQALQMAKQIKQQAQEIQKQTEELLKKVQELLKKLHQLGAPEMAKIAEELHKHAEALKQAAEEFYKHAEELHKAAEARWG</Hsp_qseq>
<Hsp_hseq>TKQEKTALNMARFIRSQ--------------TLTLLEKLHELDADEQADICESLH--------------DHADELYRSCLARFG</Hsp_hseq>
<Hsp_midline>T +EK AL MA+ I+ Q LL+KLH+L A E A I E LH HA+EL+++ AR+G</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>936828191</Statistics_db-num>
<Statistics_db-len>355460431291</Statistics_db-len>
<Statistics_hsp-len>0</Statistics_hsp-len>
<Statistics_eff-space>0</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>
特征工程/9CFS.fasta 0 → 100644
>9CFS_1|Chains A, B|Long regulatory protein rop|Escherichia coli (562)
>9CFS_1|Chains A, B|Long regulatory protein rop|Escherichia coli (562)
MGHHHHHHGTPEEKQALQMAKQIKQQAQEIQKQTEELLKKVQELLKKLHQLGAPEMAKIAEELHKHAEALKQAAEEFYKHAEELHKAAEARWG
特征工程/9cfs.pdb 0 → 100644
This source diff could not be displayed because it is too large. You can view the blob instead.
特征工程/Alfuzosin.sdf 0 → 100644
Unnamed
Unnamed
Chem3D Core 21.010272417003D
55 57 0 0 0 0 0 0 0 0999 V2000
-5.7857 1.9733 -1.0316 C 0 0 0 0 0 0 0 0 0 0 0 0
-6.0640 0.6117 -0.9700 C 0 0 0 0 0 0 0 0 0 0 0 0
-5.0178 -0.2959 -0.8280 C 0 0 0 0 0 0 0 0 0 0 0 0
-3.6902 0.1696 -0.7480 C 0 0 0 0 0 0 0 0 0 0 0 0
-3.3983 1.5375 -0.8089 C 0 0 0 0 0 0 0 0 0 0 0 0
-4.4620 2.4205 -0.9508 C 0 0 0 0 0 0 0 0 0 0 0 0
-2.5904 -0.6658 -0.6061 C 0 0 0 0 0 0 0 0 0 0 0 0
-1.3187 -0.2308 -0.5289 N 0 0 0 0 0 0 0 0 0 0 0 0
-1.1654 1.0983 -0.5987 C 0 0 0 0 0 0 0 0 0 0 0 0
-2.1444 2.0067 -0.7352 N 0 0 0 0 0 0 0 0 0 0 0 0
-6.7957 2.8660 -1.1697 O 0 0 0 0 0 0 0 0 0 0 0 0
-7.3433 0.1721 -1.0475 O 0 0 0 0 0 0 0 0 0 0 0 0
0.0187 1.5409 -0.5293 N 0 0 0 0 0 0 0 0 0 0 0 0
1.1446 0.6077 -0.3792 C 0 0 0 0 0 0 0 0 0 0 0 0
2.4496 1.3907 -0.3210 C 0 0 0 0 0 0 0 0 0 0 0 0
3.6161 0.4239 -0.1656 C 0 0 0 0 0 0 0 0 0 0 0 0
4.8585 1.1694 -0.1101 N 0 0 0 0 0 0 0 0 0 0 0 0
6.0486 0.5070 0.0284 C 0 0 0 0 0 0 0 0 0 0 0 0
6.0674 -0.9989 0.1233 C 0 0 0 0 0 0 0 0 0 0 0 0
6.7041 -1.4265 1.4400 C 0 0 0 0 0 0 0 0 0 0 0 0
7.9392 -2.2142 0.9971 C 0 0 0 0 0 0 0 0 0 0 0 0
7.5117 -2.6464 -0.3974 C 0 0 0 0 0 0 0 0 0 0 0 0
6.8390 -1.5330 -0.9214 O 0 0 0 0 0 0 0 0 0 0 0 0
7.0837 1.1281 0.0746 O 0 0 0 0 0 0 0 0 0 0 0 0
-8.0339 2.2113 -1.2306 C 0 0 0 0 0 0 0 0 0 0 0 0
-7.3951 -1.2265 -0.9651 C 0 0 0 0 0 0 0 0 0 0 0 0
-2.7961 -1.9135 -0.5456 N 0 0 0 0 0 0 0 0 0 0 0 0
0.2677 2.9880 -0.5986 C 0 0 0 0 0 0 0 0 0 0 0 0
-5.2273 -1.3746 -0.7784 H 0 0 0 0 0 0 0 0 0 0 0 0
-4.2580 3.5003 -1.0009 H 0 0 0 0 0 0 0 0 0 0 0 0
1.0200 0.0249 0.5607 H 0 0 0 0 0 0 0 0 0 0 0 0
1.1680 -0.0879 -1.2478 H 0 0 0 0 0 0 0 0 0 0 0 0
2.5742 1.9736 -1.2610 H 0 0 0 0 0 0 0 0 0 0 0 0
2.4262 2.0863 0.5476 H 0 0 0 0 0 0 0 0 0 0 0 0
3.4915 -0.1589 0.7744 H 0 0 0 0 0 0 0 0 0 0 0 0
3.6394 -0.2717 -1.0341 H 0 0 0 0 0 0 0 0 0 0 0 0
4.8459 2.1793 -0.1737 H 0 0 0 0 0 0 0 0 0 0 0 0
5.0195 -1.3686 0.0605 H 0 0 0 0 0 0 0 0 0 0 0 0
6.0110 -2.0701 2.0266 H 0 0 0 0 0 0 0 0 0 0 0 0
6.9512 -0.5671 2.1027 H 0 0 0 0 0 0 0 0 0 0 0 0
8.8466 -1.5705 0.9665 H 0 0 0 0 0 0 0 0 0 0 0 0
8.2213 -3.0511 1.6744 H 0 0 0 0 0 0 0 0 0 0 0 0
6.8325 -3.5265 -0.3448 H 0 0 0 0 0 0 0 0 0 0 0 0
8.3759 -2.9532 -1.0282 H 0 0 0 0 0 0 0 0 0 0 0 0
-8.8466 2.9634 -1.3438 H 0 0 0 0 0 0 0 0 0 0 0 0
-8.0449 1.5199 -2.1027 H 0 0 0 0 0 0 0 0 0 0 0 0
-8.1932 1.6314 -0.2941 H 0 0 0 0 0 0 0 0 0 0 0 0
-8.4538 -1.5637 -1.0309 H 0 0 0 0 0 0 0 0 0 0 0 0
-6.8126 -1.6689 -1.8040 H 0 0 0 0 0 0 0 0 0 0 0 0
-6.9602 -1.5572 0.0046 H 0 0 0 0 0 0 0 0 0 0 0 0
-3.7756 -2.2875 -0.6027 H 0 0 0 0 0 0 0 0 0 0 0 0
-1.9872 -2.5744 -0.4384 H 0 0 0 0 0 0 0 0 0 0 0 0
-0.6998 3.5265 -0.7112 H 0 0 0 0 0 0 0 0 0 0 0 0
0.7713 3.3225 0.3359 H 0 0 0 0 0 0 0 0 0 0 0 0
0.9199 3.2106 -1.4726 H 0 0 0 0 0 0 0 0 0 0 0 0
1 2 2 0
1 6 1 0
1 11 1 0
3 2 1 0
2 12 1 0
4 3 2 0
3 29 1 0
5 4 1 0
7 4 1 0
6 5 2 0
5 10 1 0
6 30 1 0
8 7 2 0
7 27 1 0
9 8 1 0
10 9 2 0
9 13 1 0
11 25 1 0
12 26 1 0
13 14 1 0
13 28 1 0
14 15 1 0
14 31 1 0
14 32 1 0
15 16 1 0
15 33 1 0
15 34 1 0
16 17 1 0
16 35 1 0
16 36 1 0
17 18 1 0
17 37 1 0
18 19 1 0
18 24 2 0
19 20 1 0
23 19 1 0
19 38 1 0
20 21 1 0
20 39 1 0
20 40 1 0
21 22 1 0
21 41 1 0
21 42 1 0
23 22 1 0
22 43 1 0
22 44 1 0
25 45 1 0
25 46 1 0
25 47 1 0
26 48 1 0
26 49 1 0
26 50 1 0
27 51 1 0
27 52 1 0
28 53 1 0
28 54 1 0
28 55 1 0
M END
$$$$
特征工程/__init__.py 0 → 100644
++ "a/\347\211\271\345\276\201\345\267\245\347\250\213/__init__.py"
特征工程/biopython.ipynb 0 → 100644
This source diff could not be displayed because it is too large. You can view the blob instead.
特征工程/blast_result.xml 0 → 100644
<?xml version="1.0" encoding="US-ASCII"?>
<?xml version="1.0" encoding="US-ASCII"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>blastp</BlastOutput_program>
<BlastOutput_version>BLASTP 2.17.0+</BlastOutput_version>
<BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
<BlastOutput_db>nt</BlastOutput_db>
<BlastOutput_query-ID>Query_3881555</BlastOutput_query-ID>
<BlastOutput_query-def>unnamed protein product</BlastOutput_query-def>
<BlastOutput_query-len>93</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>10</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>Query_3881555</Iteration_query-ID>
<Iteration_query-def>unnamed protein product</Iteration_query-def>
<Iteration_query-len>93</Iteration_query-len>
<Iteration_hits>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>0</Statistics_db-num>
<Statistics_db-len>0</Statistics_db-len>
<Statistics_hsp-len>0</Statistics_hsp-len>
<Statistics_eff-space>0</Statistics_eff-space>
<Statistics_kappa>-1</Statistics_kappa>
<Statistics_lambda>-1</Statistics_lambda>
<Statistics_entropy>-1</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>
特征工程/ecoli.gb 0 → 100644
LOCUS NC_000913 4641652 bp DNA circular CON 09-MAR-2022
LOCUS NC_000913 4641652 bp DNA circular CON 09-MAR-2022
DEFINITION Escherichia coli str. K-12 substr. MG1655, complete genome.
ACCESSION NC_000913
VERSION NC_000913.3
DBLINK BioProject: PRJNA57779
BioSample: SAMN02604091
KEYWORDS RefSeq.
SOURCE Escherichia coli str. K-12 substr. MG1655
ORGANISM Escherichia coli str. K-12 substr. MG1655
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE 1 (bases 1 to 4641652)
AUTHORS Riley,M., Abe,T., Arnaud,M.B., Berlyn,M.K., Blattner,F.R.,
Chaudhuri,R.R., Glasner,J.D., Horiuchi,T., Keseler,I.M., Kosuge,T.,
Mori,H., Perna,N.T., Plunkett,G. III, Rudd,K.E., Serres,M.H.,
Thomas,G.H., Thomson,N.R., Wishart,D. and Wanner,B.L.
TITLE Escherichia coli K-12: a cooperatively developed annotation
snapshot--2005
JOURNAL Nucleic Acids Res. 34 (1), 1-9 (2006)
PUBMED 16397293
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 4641652)
AUTHORS Hayashi,K., Morooka,N., Yamamoto,Y., Fujita,K., Isono,K., Choi,S.,
Ohtsubo,E., Baba,T., Wanner,B.L., Mori,H. and Horiuchi,T.
TITLE Highly accurate genome sequences of Escherichia coli K-12 strains
MG1655 and W3110
JOURNAL Mol. Syst. Biol. 2, 2006 (2006)
PUBMED 16738553
REFERENCE 3 (bases 1 to 4641652)
AUTHORS Blattner,F.R., Plunkett,G. III, Bloch,C.A., Perna,N.T., Burland,V.,
Riley,M., Collado-Vides,J., Glasner,J.D., Rode,C.K., Mayhew,G.F.,
Gregor,J., Davis,N.W., Kirkpatrick,H.A., Goeden,M.A., Rose,D.J.,
Mau,B. and Shao,Y.
TITLE The complete genome sequence of Escherichia coli K-12
JOURNAL Science 277 (5331), 1453-1462 (1997)
PUBMED 9278503
REFERENCE 4 (bases 1 to 4641652)
AUTHORS Arnaud,M., Berlyn,M.K.B., Blattner,F.R., Galperin,M.Y.,
Glasner,J.D., Horiuchi,T., Kosuge,T., Mori,H., Perna,N.T.,
Plunkett,G. III, Riley,M., Rudd,K.E., Serres,M.H., Thomas,G.H. and
Wanner,B.L.
TITLE Workshop on Annotation of Escherichia coli K-12
JOURNAL Unpublished
REMARK Woods Hole, Mass., on 14-18 November 2003 (sequence corrections)
REFERENCE 5 (bases 1 to 4641652)
AUTHORS Glasner,J.D., Perna,N.T., Plunkett,G. III, Anderson,B.D.,
Bockhorst,J., Hu,J.C., Riley,M., Rudd,K.E. and Serres,M.H.
TITLE ASAP: Escherichia coli K-12 strain MG1655 version m56
JOURNAL Unpublished
REMARK ASAP download 10 June 2004 (annotation updates)
REFERENCE 6 (bases 1 to 4641652)
AUTHORS Hayashi,K., Morooka,N., Mori,H. and Horiuchi,T.
TITLE A more accurate sequence comparison between genomes of Escherichia
coli K12 W3110 and MG1655 strains
JOURNAL Unpublished
REMARK GenBank accessions AG613214 to AG613378 (sequence corrections)
REFERENCE 7 (bases 1 to 4641652)
AUTHORS Perna,N.T.
TITLE Escherichia coli K-12 MG1655 yqiK-rfaE intergenic region, genomic
sequence correction
JOURNAL Unpublished
REMARK GenBank accession AY605712 (sequence corrections)
REFERENCE 8 (bases 1 to 4641652)
AUTHORS Rudd,K.E.
TITLE A manual approach to accurate translation start site annotation: an
E. coli K-12 case study
JOURNAL Unpublished
REFERENCE 9 (bases 1 to 4641652)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (08-MAR-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 10 (bases 1 to 4641652)
AUTHORS Blattner,F.R. and Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (30-JUL-2014) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REMARK Protein update by submitter
REFERENCE 11 (bases 1 to 4641652)
AUTHORS Blattner,F.R. and Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (15-NOV-2013) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REMARK Protein update by submitter
REFERENCE 12 (bases 1 to 4641652)
AUTHORS Blattner,F.R. and Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (26-SEP-2013) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REMARK Sequence update by submitter
REFERENCE 13 (bases 1 to 4641652)
AUTHORS Rudd,K.E.
TITLE Direct Submission
JOURNAL Submitted (06-FEB-2013) Department of Biochemistry and Molecular
Biology, University of Miami Miller School of Medicine, 118 Gautier
Bldg., Miami, FL 33136, USA
REMARK Sequence update by submitter
REFERENCE 14 (bases 1 to 4641652)
AUTHORS Rudd,K.E.
TITLE Direct Submission
JOURNAL Submitted (24-APR-2007) Department of Biochemistry and Molecular
Biology, University of Miami Miller School of Medicine, 118 Gautier
Bldg., Miami, FL 33136, USA
REMARK Annotation update from ecogene.org as a multi-database collaboration
REFERENCE 15 (bases 1 to 4641652)
AUTHORS Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (07-FEB-2006) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REMARK Protein updates by submitter
REFERENCE 16 (bases 1 to 4641652)
AUTHORS Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (10-JUN-2004) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REMARK Sequence update by submitter
REFERENCE 17 (bases 1 to 4641652)
AUTHORS Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (13-OCT-1998) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REFERENCE 18 (bases 1 to 4641652)
AUTHORS Blattner,F.R. and Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (02-SEP-1997) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
REFERENCE 19 (bases 1 to 4641652)
AUTHORS Blattner,F.R. and Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (16-JAN-1997) Laboratory of Genetics, University of
Wisconsin, 425G Henry Mall, Madison, WI 53706-1580, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence is identical to U00096.
On Nov 3, 2013 this sequence version replaced NC_000913.2.
Changes to proteins and annotation made on March 7, 2022. Current
U00096 annotation updates are derived from EcoCyc
https://ecocyc.org/. Suggestions for updates can be sent to
biocyc-support@ai.sri.com. These updates are being generated from a
collaboration that includes EcoCyc, the University of Wisconsin,
UniProtKB/Swiss-Prot, and the National Center for Biotechnology
Information (NCBI).
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..4641652
/organism="Escherichia coli str. K-12 substr. MG1655"
/mol_type="genomic DNA"
/strain="K-12"
/sub_strain="MG1655"
/db_xref="taxon:511145"
CONTIG join(U00096.3:1..4641652)
//
特征工程/feature_extraction.ipynb 0 → 100644
This source diff could not be displayed because it is too large. You can view the blob instead.
特征工程/feature_select.ipynb 0 → 100644
This source diff could not be displayed because it is too large. You can view the blob instead.
特征工程/genomic.gbff 0 → 100644
This source diff could not be displayed because it is too large. You can view the blob instead.
特征工程/multi.fasta 0 → 100644
>seq1 first
>seq1 first
ATGCGA
>seq2 second
GGGCCC
特征工程/output.fasta 0 → 100644
>9CFS_1|Chains A, B|Long regulatory protein rop|Escherichia coli (562)
>9CFS_1|Chains A, B|Long regulatory protein rop|Escherichia coli (562)
MGHHHHHHGTPEEKQALQMAKQIKQQAQEIQKQTEELLKKVQELLKKLHQLGAPEMAKIA
EELHKHAEALKQAAEEFYKHAEELHKAAEARWG
特征工程/output1.fasta 0 → 100644
>gene1
>gene1
ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG
Markdown is supported
0% or
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment